Vikramiya commentary on anargharaghava :

Détails bibliographiques
Auteur principal:	Deepa K B
Publié:	Kalady: Depatment of Manuscriptology, Sree Sankaracharya University of Sanskrit, 2014.
Sujets:	Ph.D Thesis Manuscriptology Ph.D Thesis Sanskrit Drama Study Literature Sanskrit Literature

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
par: Ramachandran Nair, V. K.
Publié: (1987)

Chargement en cours...

Applications of the theory of stochastic processes to physical problems
par: Alladi Ramakrishnan
Publié: (1951)

Chargement en cours...

Characterizations of probability distributions: Some characterisations of pareto and related populations
par: Hitha, N.
Publié: (1991)

Chargement en cours...

On finite mixture of Pareto and Beta distributions
par: Maya T. Nair
Publié: (2007)

Chargement en cours...

On truncated version of certain measures of inequality and stability
par: Abdul Sathar, E. I.
Publié: (2002)

Chargement en cours...

An Extended pearson system useful in reliability analysis
par: Sindu, T. K.
Publié: (2002)

Chargement en cours...

Modeling and analysis of competing risks data
par: Sreedevi,E.P
Publié: (2010)

Chargement en cours...

Some characterization problems associated with the bivariate exponential and geometric distributions
par: Muraleedharan Nair, K.R
Publié: (1990)

Chargement en cours...

Study of bayesian approach for certain reliability models
par: Nishant Agarwal
Publié: (2009)

Chargement en cours...

Characterization of probability distributions using the residual entropy function
par: Rajesh, G.
Publié: (2001)

Chargement en cours...

Studies on electrical and thermal properties of certain selected photonic matreials
par: Edwin Xavier
Publié: (1997)

Chargement en cours...

Studies in field theories at finite temperature and finite Bosonic density
par: Peter, V. J.
Publié: (1995)

Chargement en cours...

A bivariate pareto distribution with Freund's dependence structure
par: Jagathnath Krishna, K.M
Publié: (2010)

Chargement en cours...

Modeling and analysis of some heavy tailed time series
par: Hareesh, G.
Publié: (2010)

Chargement en cours...

Modelling and analysis of lifetime data using reversed hazard rates
par: Anjana, S
Publié: (2015)

Chargement en cours...

Statistical Inference:Bayesian inference in exponential and paeto populations in the presence of outliers
par: Jeevanand, E. S.
Publié: (1993)

Chargement en cours...

Surface electron properties and catalytic activity of Perrovskite type mixed oxides (ABO3) consisting of rare earth and 3d transition metals
par: Meera, V.
Publié: (1995)

Chargement en cours...

സുഗതകുമാരിയുടെ രചനകൾ: ഒരു സ്‌ത്രീവാദ പാരായണം /
par: Bindu,T.V
Publié: (2013)

Chargement en cours...

Document image segmentation and compression using artificial neural networks and evolutionary methods (Thesis)
par: Aysha V
Publié: (2013)

Chargement en cours...

Data mining approach for the identification of adverse drug events(ADE) resulting from drug-drug interactions(DDI) to improve pharmacovigilance (Thesis)
par: Sindhu, M.S
Publié: (2013)

Chargement en cours...

Classification and content based retrieval of digital mammograms and placental sonograms (Thesis)
par: Simily Joseph
Publié: (2013)

Chargement en cours...

Design and development of efficient classification schemes for web content mining (Thesis)
par: Shine N.Das
Publié: (2013)

Chargement en cours...

Mathematical morphology on hypergraph spaces and its applications in image processing (Thesis)
par: Bino Sebastian V.
Publié: (2015)

Chargement en cours...

The concept of Iswaratattva in Nyaya Sastra
par: Aryadevi, T; Guide, et autres
Publié: (2004)

Chargement en cours...

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
par: Ajayakumar, M S,Researcher, et autres
Publié: (2016)

Chargement en cours...

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
par: Chandrsekharan Nair, K; Guide, et autres
Publié: (2012)

Chargement en cours...

Treatment of karakas by Nagesa in Laghumanjusa
par: Aryadevi, T; Guide, et autres
Publié: (2003)

Chargement en cours...

ACCESS TO CREDIT BY HAWKERS: WHAT IS MISSING? THEORY AND EVIDENCE FROM INDIA
par: Mukta Gajanan Joshi
Publié: (2005)

Chargement en cours...

Metabolic responses of muslim men to changes in meal frequency during the Ramadan fast /
par: Gulec, Rezzan
Publié: (1976)

Chargement en cours...

Adverse drug reactions in commonly used anti-epileptic drugs /
par: Revikumar, K. G.

Chargement en cours...

Carnival world of Robert Kroetsch /
par: Hariharan, B.

Chargement en cours...

Dasopanishdsu upasana-vimarsanatmakamadhyayam
par: Ajikumar, P V; Researcher, et autres
Publié: (2012)

Chargement en cours...

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
par: Rajani, K P, Researcher, et autres
Publié: (2018)

Chargement en cours...

How to get a Ph.D a handbook for students and their supervisors
par: Phillips,Estelle M
Publié: (1999)

Chargement en cours...

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
par: Lali F Anand PhD
Publié: (2015)

Vikramiya commentary on anargharaghava : a study and critical edition/

Documents similaires