Loading...

QR Code

Worship of female deities in Kerala tantric texts: a socio cultural study/

Bibliographic Details
Main Author:	Ranjini M V
Published:	Kalady: Sree Sankaracharya University of Sanskrit, 2014.
Subjects:	Female Deities > Kerala Religion Ph.D Thesis Literature Sanskrit Literature Sanskrit Literature

Similar Items

Female deities in vedic and epic literature /
Published: (1990)

Hindu deities worshipped in Japan
by: Behl, Benoy K
Published: (2019)

Ratnaketudaya: study and critical edition
by: Jeena George; Researcher, et al.
Published: (2000)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
by: Chandrsekharan Nair, K; Guide, et al.
Published: (2012)

Treatment of karakas by Nagesa in Laghumanjusa
by: Aryadevi, T; Guide, et al.
Published: (2003)

Influence of the story of saugandhikaharana on Kerala theatre
by: Aryadevi, T; Guide, et al.
Published: (2004)

Navabharata kavya: a critical study
by: Pushpadasan Kuniyil
Published: (2013)

The concept of Iswaratattva in Nyaya Sastra
by: Aryadevi, T; Guide, et al.
Published: (2004)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
by: Ajayakumar, M S,Researcher, et al.
Published: (2016)

JURISTIC PERSONALITY OF HINDU DEITIES
by: BACCHI S C
Published: (1933)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
by: Ajikumar, P V; Researcher, et al.
Published: (2012)

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
by: Rajani, K P, Researcher, et al.
Published: (2018)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
by: Ramaswamy Iyengar, A; Guide, et al.
Published: (2011)

Index of PH.D theses in sanskrit
by: Prabath Singh Thakur
Published: (2011)

Vikramiya commentary on anargharaghava : a study and critical edition/
by: Deepa K B
Published: (2014)

Iconography of Jaina deities (v.1)
by: Shanti Lal Nagar
Published: (1999)

Iconography of Jaina deities (v.2)
by: Shanti Lal Nagar
Published: (1999)

Socio economic aspects of development of aquaculture in Kerala
by: Ajaya Kumar, C; Researcher, et al.
Published: (2012)

Microbial enzyme production utilizing Banana wastes
by: Krishna, C.
Published: (1995)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
by: Ramachandran Nair, V. K.
Published: (1987)

Applications of the theory of stochastic processes to physical problems
by: Alladi Ramakrishnan
Published: (1951)

Characterizations of probability distributions: Some characterisations of pareto and related populations
by: Hitha, N.
Published: (1991)

On finite mixture of Pareto and Beta distributions
by: Maya T. Nair
Published: (2007)

On truncated version of certain measures of inequality and stability
by: Abdul Sathar, E. I.
Published: (2002)

An Extended pearson system useful in reliability analysis
by: Sindu, T. K.
Published: (2002)

Modeling and analysis of competing risks data
by: Sreedevi,E.P
Published: (2010)

Some characterization problems associated with the bivariate exponential and geometric distributions
by: Muraleedharan Nair, K.R
Published: (1990)

Study of bayesian approach for certain reliability models
by: Nishant Agarwal
Published: (2009)

Characterization of probability distributions using the residual entropy function
by: Rajesh, G.
Published: (2001)

Studies on electrical and thermal properties of certain selected photonic matreials
by: Edwin Xavier
Published: (1997)

Studies in field theories at finite temperature and finite Bosonic density
by: Peter, V. J.
Published: (1995)

A bivariate pareto distribution with Freund's dependence structure
by: Jagathnath Krishna, K.M
Published: (2010)

Modeling and analysis of some heavy tailed time series
by: Hareesh, G.
Published: (2010)

Modelling and analysis of lifetime data using reversed hazard rates
by: Anjana, S
Published: (2015)

Analysis of stochastic volatility sequences generated by product autoregressive models
by: Shiji, K
Published: (2014)

A Quantile based analysis of income data
by: Sreelakshmi, N
Published: (2014)

Reliability concepts in quantile based analysis of lifetime data
by: Vineshkumar, B
Published: (2012)

Statistical Inference:Bayesian inference in exponential and paeto populations in the presence of outliers
by: Jeevanand, E. S.
Published: (1993)

Surface electron properties and catalytic activity of Perrovskite type mixed oxides (ABO3) consisting of rare earth and 3d transition metals
by: Meera, V.
Published: (1995)

സുഗതകുമാരിയുടെ രചനകൾ: ഒരു സ്‌ത്രീവാദ പാരായണം /
by: Bindu,T.V
Published: (2013)

Cannot write session to /tmp/vufind_sessions/sess_ku9ag5a8grvjr7vpc0vb539s58