Loading...

QR Code

Navabharata kavya: a critical study

Bibliographic Details
Main Author:	Pushpadasan Kuniyil
Published:	Kalady Sree Sankaracharya University of Sanskrit 2013
Subjects:	Literature Sanskrit > Ph D Thesis Literature Sanskrit
Online Access:	http://hdl.handle.net/10603/79629

Similar Items

Ratnaketudaya: study and critical edition
by: Jeena George; Researcher, et al.
Published: (2000)

Vikramiya commentary on anargharaghava : a study and critical edition/
by: Deepa K B
Published: (2014)

Navabharata retangal /
by: Prabhakaran, Peroor S.
Published: (1994)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
by: Chandrsekharan Nair, K; Guide, et al.
Published: (2012)

Treatment of karakas by Nagesa in Laghumanjusa
by: Aryadevi, T; Guide, et al.
Published: (2003)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
by: Ajayakumar, M S,Researcher, et al.
Published: (2016)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
by: Ramaswamy Iyengar, A; Guide, et al.
Published: (2011)

Worship of female deities in Kerala tantric texts: a socio cultural study/
by: Ranjini M V
Published: (2014)

Adhikarasutrasameeksha
by: Sunilkumar Nair K
Published: (2013)

The concept of Iswaratattva in Nyaya Sastra
by: Aryadevi, T; Guide, et al.
Published: (2004)

Rasamanjari on Malatimadhava: a study
by: Paulose, K G; Guide, et al.
Published: (2006)

Index of PH.D theses in sanskrit
by: Prabath Singh Thakur
Published: (2011)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
by: Ajikumar, P V; Researcher, et al.
Published: (2012)

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
by: Rajani, K P, Researcher, et al.
Published: (2018)

Kavyakalanidhi of Krsnasudhi: a critical edition and study
by: Jayageetha, K N; Researcher, et al.
Published: (1998)

Adbhutapanjaram of Narayana Dikshita: a critical study
by: Ambika, C P; Researcher, et al.
Published: (1999)

Paschatya kavya sastra/
by: Krishnadev Sharma
Published: (1994)

Concept of upamana: a critical study
by: Arya Devi, T; Guide, et al.
Published: (2004)

Samskrte kriyavisesanani nirupanam/
by: Sindhu K Kumar
Published: (2015)

Karakatattva of Sesacakrapani: an edition and study
by: Leela, K N; Researcher, et al.
Published: (2006)

Historical, social and cultural gleanings in the campu kavyas of Kerala
by: Mini T
Published: (2003)

Contribution of Pariksit Tampuran to Sanskrit literature
by: Geetha, K P; Researcher, et al.
Published: (1999)

Influence of the story of saugandhikaharana on Kerala theatre
by: Aryadevi, T; Guide, et al.
Published: (2004)

The Motif of Tirtha in major Puranas:a study with special reference to Skandamahapurana
by: Suma K U
Published: (2014)

Kavya mimamsa of Rajasekhara/
by: Rajasekhara
Published: (1982)

The role of women in kutiyattam: a study
by: Minidevi, P R; Researcher, et al.
Published: (2009)

Naisadhiyacarita- a grammatical evaluation
by: Gangadharan Nair, G; Guide, et al.
Published: (2007)

Bharatiya kavya sastra mimamsa/
Published: (1995)

Krishnabhakti kavya mein sakhibhava
by: Sharan Bihari Goswami
Published: (1966)

Mahatma Gandhipark sanskrit kavya/
by: Kumud Tandon
Published: (1991)

Philosophy of Carakasamhita
by: Asokan, G; Researcher, et al.
Published: (2009)

Study of bayesian approach for certain reliability models
by: Nishant Agarwal
Published: (2009)

Studies on electrical and thermal properties of certain selected photonic matreials
by: Edwin Xavier
Published: (1997)

Studies in field theories at finite temperature and finite Bosonic density
by: Peter, V. J.
Published: (1995)

Brhadaranyakopanishad: a study
by: Gangadharan Nair, G; Guide, et al.
Published: (1999)

Contribution of K Kunjunni Raja to Sanskrit research
by: Aryambika S V
Published: (2014)

A Quantile based analysis of income data
by: Sreelakshmi, N
Published: (2014)

Hastalaksanadipika: a critical edition and study
by: Sudha, E K; Researcher, et al.
Published: (2004)

A bivariate pareto distribution with Freund's dependence structure
by: Jagathnath Krishna, K.M
Published: (2010)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
by: Ramachandran Nair, V. K.
Published: (1987)

Cannot write session to /tmp/vufind_sessions/sess_g3gmi68hc3nqulbtvn7702p8vk