Vikramiya commentary on anargharaghava :

Podrobná bibliografie
Hlavní autor:	Deepa K B
Vydáno:	Kalady: Depatment of Manuscriptology, Sree Sankaracharya University of Sanskrit, 2014.
Témata:	Ph.D Thesis Manuscriptology Ph.D Thesis Sanskrit Drama Study Literature Sanskrit Literature

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
Autor: Ramachandran Nair, V. K.
Vydáno: (1987)

Načítá se...

Applications of the theory of stochastic processes to physical problems
Autor: Alladi Ramakrishnan
Vydáno: (1951)

Načítá se...

Characterizations of probability distributions: Some characterisations of pareto and related populations
Autor: Hitha, N.
Vydáno: (1991)

Načítá se...

On finite mixture of Pareto and Beta distributions
Autor: Maya T. Nair
Vydáno: (2007)

Načítá se...

On truncated version of certain measures of inequality and stability
Autor: Abdul Sathar, E. I.
Vydáno: (2002)

Načítá se...

An Extended pearson system useful in reliability analysis
Autor: Sindu, T. K.
Vydáno: (2002)

Načítá se...

Modeling and analysis of competing risks data
Autor: Sreedevi,E.P
Vydáno: (2010)

Načítá se...

Some characterization problems associated with the bivariate exponential and geometric distributions
Autor: Muraleedharan Nair, K.R
Vydáno: (1990)

Načítá se...

Study of bayesian approach for certain reliability models
Autor: Nishant Agarwal
Vydáno: (2009)

Načítá se...

Characterization of probability distributions using the residual entropy function
Autor: Rajesh, G.
Vydáno: (2001)

Načítá se...

Studies on electrical and thermal properties of certain selected photonic matreials
Autor: Edwin Xavier
Vydáno: (1997)

Načítá se...

Studies in field theories at finite temperature and finite Bosonic density
Autor: Peter, V. J.
Vydáno: (1995)

Načítá se...

A bivariate pareto distribution with Freund's dependence structure
Autor: Jagathnath Krishna, K.M
Vydáno: (2010)

Načítá se...

Modeling and analysis of some heavy tailed time series
Autor: Hareesh, G.
Vydáno: (2010)

Načítá se...

Modelling and analysis of lifetime data using reversed hazard rates
Autor: Anjana, S
Vydáno: (2015)

Načítá se...

Statistical Inference:Bayesian inference in exponential and paeto populations in the presence of outliers
Autor: Jeevanand, E. S.
Vydáno: (1993)

Načítá se...

Surface electron properties and catalytic activity of Perrovskite type mixed oxides (ABO3) consisting of rare earth and 3d transition metals
Autor: Meera, V.
Vydáno: (1995)

Načítá se...

സുഗതകുമാരിയുടെ രചനകൾ: ഒരു സ്‌ത്രീവാദ പാരായണം /
Autor: Bindu,T.V
Vydáno: (2013)

Načítá se...

Document image segmentation and compression using artificial neural networks and evolutionary methods (Thesis)
Autor: Aysha V
Vydáno: (2013)

Načítá se...

Data mining approach for the identification of adverse drug events(ADE) resulting from drug-drug interactions(DDI) to improve pharmacovigilance (Thesis)
Autor: Sindhu, M.S
Vydáno: (2013)

Načítá se...

Classification and content based retrieval of digital mammograms and placental sonograms (Thesis)
Autor: Simily Joseph
Vydáno: (2013)

Načítá se...

Design and development of efficient classification schemes for web content mining (Thesis)
Autor: Shine N.Das
Vydáno: (2013)

Načítá se...

Mathematical morphology on hypergraph spaces and its applications in image processing (Thesis)
Autor: Bino Sebastian V.
Vydáno: (2015)

Načítá se...

The concept of Iswaratattva in Nyaya Sastra
Autor: Aryadevi, T; Guide, a další
Vydáno: (2004)

Načítá se...

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
Autor: Ajayakumar, M S,Researcher, a další
Vydáno: (2016)

Načítá se...

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
Autor: Chandrsekharan Nair, K; Guide, a další
Vydáno: (2012)

Načítá se...

Treatment of karakas by Nagesa in Laghumanjusa
Autor: Aryadevi, T; Guide, a další
Vydáno: (2003)

Načítá se...

ACCESS TO CREDIT BY HAWKERS: WHAT IS MISSING? THEORY AND EVIDENCE FROM INDIA
Autor: Mukta Gajanan Joshi
Vydáno: (2005)

Načítá se...

Metabolic responses of muslim men to changes in meal frequency during the Ramadan fast /
Autor: Gulec, Rezzan
Vydáno: (1976)

Načítá se...

Adverse drug reactions in commonly used anti-epileptic drugs /
Autor: Revikumar, K. G.

Načítá se...

Carnival world of Robert Kroetsch /
Autor: Hariharan, B.

Načítá se...

Dasopanishdsu upasana-vimarsanatmakamadhyayam
Autor: Ajikumar, P V; Researcher, a další
Vydáno: (2012)

Načítá se...

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
Autor: Rajani, K P, Researcher, a další
Vydáno: (2018)

Načítá se...

How to get a Ph.D a handbook for students and their supervisors
Autor: Phillips,Estelle M
Vydáno: (1999)

Načítá se...

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
Autor: Lali F Anand PhD
Vydáno: (2015)

Vikramiya commentary on anargharaghava : a study and critical edition/

Podobné jednotky