Loading...

QR Code

Treatment of music in Natyasastra and its application in Sanskrit plays/

Bibliographic Details
Main Authors:	Saritha Maheswaran, Researcher, Madhavan, K T, Guide
Corporate Author:	Mahatma Gandhi University, Kottayam Department of Sanskrit, Government Sanskrit College, Tripunithura
Format:	Ph.D Thesis
Published:	Kottayam: Mahatma Gandhi University, 2015.
Subjects:	Thesis(Ph.D)- Sanskrit. Dissertations, Academic(Ph.D). Sanskrit drama- History and criticism. Music- India. Theater- India.
Online Access:	http://www.mgutheses.in/page/?q=T%202671&search=&page=1&rad=acc

Similar Items

Treatment of karakas by Nagesa in Laghumanjusa
by: Aryadevi, T; Guide, et al.
Published: (2003)

How to get a Ph.D a handbook for students and their supervisors
by: Phillips,Estelle M
Published: (1999)

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
by: Lali F Anand PhD
Published: (2015)

Clinical evaluation and surgical management of pigmentary keratitis in dogs
by: Anoop,s
Published: (2015)

The concept of Iswaratattva in Nyaya Sastra
by: Aryadevi, T; Guide, et al.
Published: (2004)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
by: Ajayakumar, M S,Researcher, et al.
Published: (2016)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
by: Chandrsekharan Nair, K; Guide, et al.
Published: (2012)

Ratnaketudaya: study and critical edition
by: Jeena George; Researcher, et al.
Published: (2000)

Keralathile theatere- avatharanam: Kavalathinte theaterene munnirthi oru padanam
by: Raja, G; Researcher, et al.
Published: (2003)

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
by: Rajani, K P, Researcher, et al.
Published: (2018)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
by: Ramaswamy Iyengar, A; Guide, et al.
Published: (2011)

Contribution of A R Rajaraja Varma to Sanskrit grammar
by: Lila, M L; Researcher, et al.
Published: (2000)

Index of PH.D theses in sanskrit
by: Prabath Singh Thakur
Published: (2011)

Preparation and testing of certain constructs in teaching sanskrit in higher education
by: Reghu, V; Guide, et al.
Published: (2004)

A comparative study of the contributions of Benjamin Bailey and William Carey to Indian education
by: Anandan Nair, K; Guide, et al.
Published: (2001)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
by: Ajikumar, P V; Researcher, et al.
Published: (2012)

Ph.D theses see T009

Microbial enzyme production utilizing Banana wastes
by: Krishna, C.
Published: (1995)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
by: Ramachandran Nair, V. K.
Published: (1987)

Applications of the theory of stochastic processes to physical problems
by: Alladi Ramakrishnan
Published: (1951)

Characterizations of probability distributions: Some characterisations of pareto and related populations
by: Hitha, N.
Published: (1991)

On finite mixture of Pareto and Beta distributions
by: Maya T. Nair
Published: (2007)

On truncated version of certain measures of inequality and stability
by: Abdul Sathar, E. I.
Published: (2002)

An Extended pearson system useful in reliability analysis
by: Sindu, T. K.
Published: (2002)

Modeling and analysis of competing risks data
by: Sreedevi,E.P
Published: (2010)

Some characterization problems associated with the bivariate exponential and geometric distributions
by: Muraleedharan Nair, K.R
Published: (1990)

Study of bayesian approach for certain reliability models
by: Nishant Agarwal
Published: (2009)

Characterization of probability distributions using the residual entropy function
by: Rajesh, G.
Published: (2001)

Studies on electrical and thermal properties of certain selected photonic matreials
by: Edwin Xavier
Published: (1997)

Studies in field theories at finite temperature and finite Bosonic density
by: Peter, V. J.
Published: (1995)

The Ph.D process a students guide to graduate school in the sciences
by: Bloom,Dale F
Published: (1998)

A bivariate pareto distribution with Freund's dependence structure
by: Jagathnath Krishna, K.M
Published: (2010)

Modeling and analysis of some heavy tailed time series
by: Hareesh, G.
Published: (2010)

Modelling and analysis of lifetime data using reversed hazard rates
by: Anjana, S
Published: (2015)

Analysis of stochastic volatility sequences generated by product autoregressive models
by: Shiji, K
Published: (2014)

A Quantile based analysis of income data
by: Sreelakshmi, N
Published: (2014)

Reliability concepts in quantile based analysis of lifetime data
by: Vineshkumar, B
Published: (2012)

Statistical Inference:Bayesian inference in exponential and paeto populations in the presence of outliers
by: Jeevanand, E. S.
Published: (1993)

Surface electron properties and catalytic activity of Perrovskite type mixed oxides (ABO3) consisting of rare earth and 3d transition metals
by: Meera, V.
Published: (1995)

Ph D.theses see T006