Caricamento...

Codice QR

Treatment of music in Natyasastra and its application in Sanskrit plays/

Dettagli Bibliografici
Autori principali:	Saritha Maheswaran, Researcher, Madhavan, K T, Guide
Ente Autore:	Mahatma Gandhi University, Kottayam Department of Sanskrit, Government Sanskrit College, Tripunithura
Natura:	Ph.D Thesis
Pubblicazione:	Kottayam: Mahatma Gandhi University, 2015.
Soggetti:	Thesis(Ph.D)- Sanskrit. Dissertations, Academic(Ph.D). Sanskrit drama- History and criticism. Music- India. Theater- India.
Accesso online:	http://www.mgutheses.in/page/?q=T%202671&search=&page=1&rad=acc

Documenti analoghi

Treatment of karakas by Nagesa in Laghumanjusa
di: Aryadevi, T; Guide, et al.
Pubblicazione: (2003)

How to get a Ph.D a handbook for students and their supervisors
di: Phillips,Estelle M
Pubblicazione: (1999)

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
di: Lali F Anand PhD
Pubblicazione: (2015)

Clinical evaluation and surgical management of pigmentary keratitis in dogs
di: Anoop,s
Pubblicazione: (2015)

The concept of Iswaratattva in Nyaya Sastra
di: Aryadevi, T; Guide, et al.
Pubblicazione: (2004)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
di: Ajayakumar, M S,Researcher, et al.
Pubblicazione: (2016)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
di: Chandrsekharan Nair, K; Guide, et al.
Pubblicazione: (2012)

Ratnaketudaya: study and critical edition
di: Jeena George; Researcher, et al.
Pubblicazione: (2000)

Keralathile theatere- avatharanam: Kavalathinte theaterene munnirthi oru padanam
di: Raja, G; Researcher, et al.
Pubblicazione: (2003)

Psychological approach on anti heroism in Duryodhana with special reference to Mahabharata and allied literature/
di: Rajani, K P, Researcher, et al.
Pubblicazione: (2018)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
di: Ramaswamy Iyengar, A; Guide, et al.
Pubblicazione: (2011)

Contribution of A R Rajaraja Varma to Sanskrit grammar
di: Lila, M L; Researcher, et al.
Pubblicazione: (2000)

Index of PH.D theses in sanskrit
di: Prabath Singh Thakur
Pubblicazione: (2011)

Preparation and testing of certain constructs in teaching sanskrit in higher education
di: Reghu, V; Guide, et al.
Pubblicazione: (2004)

A comparative study of the contributions of Benjamin Bailey and William Carey to Indian education
di: Anandan Nair, K; Guide, et al.
Pubblicazione: (2001)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
di: Ajikumar, P V; Researcher, et al.
Pubblicazione: (2012)

Ph.D theses see T009

Microbial enzyme production utilizing Banana wastes
di: Krishna, C.
Pubblicazione: (1995)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
di: Ramachandran Nair, V. K.
Pubblicazione: (1987)

Applications of the theory of stochastic processes to physical problems
di: Alladi Ramakrishnan
Pubblicazione: (1951)

Characterizations of probability distributions: Some characterisations of pareto and related populations
di: Hitha, N.
Pubblicazione: (1991)

On finite mixture of Pareto and Beta distributions
di: Maya T. Nair
Pubblicazione: (2007)

On truncated version of certain measures of inequality and stability
di: Abdul Sathar, E. I.
Pubblicazione: (2002)

An Extended pearson system useful in reliability analysis
di: Sindu, T. K.
Pubblicazione: (2002)

Modeling and analysis of competing risks data
di: Sreedevi,E.P
Pubblicazione: (2010)

Some characterization problems associated with the bivariate exponential and geometric distributions
di: Muraleedharan Nair, K.R
Pubblicazione: (1990)

Study of bayesian approach for certain reliability models
di: Nishant Agarwal
Pubblicazione: (2009)

Characterization of probability distributions using the residual entropy function
di: Rajesh, G.
Pubblicazione: (2001)

Studies on electrical and thermal properties of certain selected photonic matreials
di: Edwin Xavier
Pubblicazione: (1997)

Studies in field theories at finite temperature and finite Bosonic density
di: Peter, V. J.
Pubblicazione: (1995)

The Ph.D process a students guide to graduate school in the sciences
di: Bloom,Dale F
Pubblicazione: (1998)

A bivariate pareto distribution with Freund's dependence structure
di: Jagathnath Krishna, K.M
Pubblicazione: (2010)

Modeling and analysis of some heavy tailed time series
di: Hareesh, G.
Pubblicazione: (2010)

Modelling and analysis of lifetime data using reversed hazard rates
di: Anjana, S
Pubblicazione: (2015)

Analysis of stochastic volatility sequences generated by product autoregressive models
di: Shiji, K
Pubblicazione: (2014)

A Quantile based analysis of income data
di: Sreelakshmi, N
Pubblicazione: (2014)

Reliability concepts in quantile based analysis of lifetime data
di: Vineshkumar, B
Pubblicazione: (2012)

Statistical Inference:Bayesian inference in exponential and paeto populations in the presence of outliers
di: Jeevanand, E. S.
Pubblicazione: (1993)

Surface electron properties and catalytic activity of Perrovskite type mixed oxides (ABO3) consisting of rare earth and 3d transition metals
di: Meera, V.
Pubblicazione: (1995)

Ph D.theses see T006