Loading...

QR Code

Malayala kathaakaavyangal {Edasseri, Olappamanna, O N V}

Bibliographic Details
Main Authors:	Brincy Mathew; Researcher, Philip John; Guide
Format:	Ph.D Thesis
Published:	Kottayam, Mahatma Gandhi University 2012
Edition:	Ph.D
Subjects:	Dissertations, Academic (Ph.D) Govindan Nair, Edasseri-Criticism and interpretation Kurup, O N V-Criticism and interpretation Malayalam poetry-History and criticism Subramaniyan Namboothirippad, Olappamanna-Criticism and interpretation Thesis (Ph.D)-Malayalam literature

Similar Items

Edasseri Govindan Nairude kavi vyakthithvam
by: Leelamma, C P; Guide, et al.
Published: (1996)

Asan thottu Edasseri vare
by: Meerakkutty, P; Author
Published: (1988)

Kerala samskrtiyude swaadheenam Edasseri Govindan Nairude kavithayil
by: Marykutty, M A; Researcher, et al.
Published: (2010)

Malayalathile akaalpanikakavitha: N V, Edasserry ennivare aaspadamaakhiya padanam
by: Harikumar, S; Researcher, et al.
Published: (2008)

Naadoodipaaramparyam-Edassery, Vailoppilly ennivarude kavithakalil
by: Lissy Joseph; Guide, et al.
Published: (2009)

Onam as described in Malayalam poetry: a study with special references to Edassery, P Kunjiraman Nair and Vyloppilly
by: Suraja, E M; Researcher, et al.
Published: (2012)

Ini nhaanunarnnirikkaam: O N V kavithapadanam
by: Rajasekharan, S; Editor
Published: (2009)

EDASSERI GOVINDAN NAIR
by: GOVINDAN,NAIR.EDASSERI
Published: (1988)

Edassery Govindan Nair /
by: Leelavathy, P.
Published: (1998)

Treatment of myth in the poetry of Edassery Govindan Nair(മിത്തുകളുടെ ആവിഷ്കാരം ഇടശ്ശേരി ഗോവിന്ദൻ നായരുടെ കവിതകളിൽ)/
by: Anila G Nair(അനില ജി നായർ), Researcher, et al.
Published: (2016)

Mathaathmaka bimbangalum padaavaliyum G Sankara Kurup, O N V Kurup ennivarude kavithakalil: oru pathanam
by: Babuji, M G; Researcher, et al.
Published: (2004)

Edasserikkavitha /
by: Chandrasekharan, Melath
Published: (2012)

Sacrifice as motif in W B Yeats and Edasseri Govindan Nair
by: Harris, V C; Guide, et al.
Published: (1999)

Prethyayasaasthraabhimukhyangalum vyathiyaanangalum Vayalar, O N V ennivarude kavithakalil: oru padanam
by: Rajan, R; Researcher, et al.
Published: (2001)

O N V kavitha: mozhiyum porulum
by: Jolly Zacharia; Author
Published: (1999)

Anviksiki disa Bhagavata puranasya padanam
by: Presanna Antharjanam, M N; Researcher, et al.
Published: (2010)

Kaviyum kavithayum(കവിയും കവിതയും)/
by: Narayana Kurup, P(നാരായണക്കുറുപ്പ്, പി)
Published: (2004)

Paaramparyavum paaramparya nishedhavum O V Vijayante kathaaprapanchathil
by: Sarojini Amma, S; Guide, et al.
Published: (2009)

Ayyappa Panickeruteyum M Govindanteyum sailikal - Malayala kaavyabhaashayil varuthiya vyathiyaanangal - saileevijnaanaparamaaya oru sameepanam
by: James, V; Researcher, et al.
Published: (2010)

Dr. Lakshminarayan Lal aur Sri. N N Pillai ki naatya krtiyon ka tulanaatmak adhyayan
by: Johnykutty, G; Guide, et al.
Published: (2002)

Reflections
by: Gopinathan Pillai, C; Author
Published: (2007)

Marxist saundaryasaasthrathinte swaadheenam O N V, P Bhaskaran, Vayalar ennivarude 1960 vareyulla kavithakalil: oru pathanam
by: Babu Sebastian; Guide, et al.
Published: (2001)

New aesthetics of political fiction: a study of the strategies of demystification in the novels of Salman Rushdie, O V Vijayan and Shashi Tharoor
by: Anjana, J; Researcher, et al.
Published: (2008)

Rao Sahib O M Cheriante saahithya sambhaavanakal: oru padanam
by: Samuel Chandanappally; Guide, et al.
Published: (1995)

All o` we is one: the emergence of a composite identity in the novels of Paule Marshall
by: Kochuthresiamma, P J; Guide, et al.
Published: (2009)

Mythographers and mythoclasts: a comparative study of the fiction of Gabriel Garcia Marquez and O V Vijayan
by: Krishnan, K M; Guide, et al.
Published: (2006)

Regressive patterns of human relationships in the fiction of Flannery O`Connor: a socio-psychological analysis
by: Chacko, P M; Guide, et al.
Published: (2000)

O.N.V. yude kavi janmangal /
by: Soman, P.
Published: (2011)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
by: Ajikumar, P V; Researcher, et al.
Published: (2012)

Flannery O`Connor: theory and practice of fiction
by: Joseph J Puthaman, Fr; Researcher, et al.
Published: (2000)

Vadakkanpaattukalude aakhyaanakhadana: aakhyanasaasthram avalambamaakki oru pathanam
by: Antony, P; Researcher, et al.
Published: (1999)

Akhyaanathantram: Urubinteyum M T Vasudevan Nairudeyum M Mukundanteyum novalukalil
by: Shamla, U; Researcher, et al.
Published: (2011)

Edasserikkavitha(ഇടശ്ശേരിക്കവിത)/
by: Chandrasekharan, Melath(ചന്ദശേഖരൻ, മേലത്ത്)
Published: (2012)

Edasserikkavitha(ഇടശ്ശേരിക്കവിത): patanam(പഠനം)/
Published: (2015)

Professor N Krishna Pillayude saahithya niroopanam: oru pathanam
by: Alias, K U; Researcher, et al.
Published: (2004)

Bhagavathee Charan Varma ke upanyaasom: ek vishleshanaathmak adhyayan
by: Meena, K K; Researcher, et al.
Published: (2009)

Conception and reception: a symbiotic interface between Mahasweta Devi and Gayatri Chakravorty Spivak
by: Correya Blazy; Researcher, et al.
Published: (2011)

Ramdarash Mishra ke upanyaas: moolyabodh ke pariprekshya mein
by: Mini George; Guide, et al.
Published: (2010)

Ritual of Chicano cultural survival in the U S A: myth and reality in the plays of Luis Valdez
by: Saji, K S; Researcher, et al.
Published: (2010)

Aadhunik Hindi Ramakaavyom mem samaaj manovigyaan ki bhumika
by: Satheeshkumar, G; Researcher, et al.
Published: (1993)