Đang tải...

Mã QR

Sri Ramavarma vijaya mahaakaavyam of M Kunjan Warrier: a critical study

Chi tiết về thư mục
Những tác giả chính:	Leelamani, K; Guide, Remadevi, V; Researcher
Định dạng:	Ph.D Thesis
Được phát hành:	Kottayam, Mahatma Gandhi University 1999
Phiên bản:	Ph.D
Những chủ đề:	Criticism and interpretation Criticism, Textual Dissertations, Academic (Ph.D) Epic poetry, Sanskrit Kunjan Warrier, M Sri Ramavarma vijayam Thesis (Ph.D)-Sanskrit literature

Những quyển sách tương tự

Brhadaranyakopanishad: a study
Bằng: Gangadharan Nair, G; Guide, et al.
Được phát hành: (1999)

Kavyakalanidhi of Krsnasudhi: a critical edition and study
Bằng: Jayageetha, K N; Researcher, et al.
Được phát hành: (1998)

Adbhutapanjaram of Narayana Dikshita: a critical study
Bằng: Ambika, C P; Researcher, et al.
Được phát hành: (1999)

Naisadhiyacarita- a grammatical evaluation
Bằng: Gangadharan Nair, G; Guide, et al.
Được phát hành: (2007)

Karakatattva of Sesacakrapani: an edition and study
Bằng: Leela, K N; Researcher, et al.
Được phát hành: (2006)

s of rat-fleas influence of larval environmental factors upon adult fecundity of Xenopsylla Cheopis and X.Astia(Insecta: Siphonaptera)
Bằng: Remadevi, K
Được phát hành: (1980)

How to get a Ph.D a handbook for students and their supervisors
Bằng: Phillips,Estelle M
Được phát hành: (1999)

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
Bằng: Lali F Anand PhD
Được phát hành: (2015)

Clinical evaluation and surgical management of pigmentary keratitis in dogs
Bằng: Anoop,s
Được phát hành: (2015)

Rasamanjari on Malatimadhava: a study
Bằng: Paulose, K G; Guide, et al.
Được phát hành: (2006)

Influence of the story of saugandhikaharana on Kerala theatre
Bằng: Aryadevi, T; Guide, et al.
Được phát hành: (2004)

A study of Tarkasamgraha as a compromise between the Nyaya and Vaisesika schools of philosophy
Bằng: Arya Devi, T; Guide, et al.
Được phát hành: (2007)

Ratnaketudaya: study and critical edition
Bằng: Jeena George; Researcher, et al.
Được phát hành: (2000)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
Bằng: Ramaswamy Iyengar, A; Guide, et al.
Được phát hành: (2011)

The concept of Iswaratattva in Nyaya Sastra
Bằng: Aryadevi, T; Guide, et al.
Được phát hành: (2004)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
Bằng: Ajayakumar, M S,Researcher, et al.
Được phát hành: (2016)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
Bằng: Ajikumar, P V; Researcher, et al.
Được phát hành: (2012)

Krsnarjuniya: edition and study
Bằng: Ambika, N S; Researcher, et al.
Được phát hành: (2008)

Hastalaksanadipika: a critical edition and study
Bằng: Sudha, E K; Researcher, et al.
Được phát hành: (2004)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
Bằng: Chandrsekharan Nair, K; Guide, et al.
Được phát hành: (2012)

Treatment of karakas by Nagesa in Laghumanjusa
Bằng: Aryadevi, T; Guide, et al.
Được phát hành: (2003)

Nalacharithathile bhaasha
Bằng: Moosath, N N; Guide, et al.
Được phát hành: (1995)

Ph.D theses see T009

Microbial enzyme production utilizing Banana wastes
Bằng: Krishna, C.
Được phát hành: (1995)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
Bằng: Ramachandran Nair, V. K.
Được phát hành: (1987)

Applications of the theory of stochastic processes to physical problems
Bằng: Alladi Ramakrishnan
Được phát hành: (1951)

Characterizations of probability distributions: Some characterisations of pareto and related populations
Bằng: Hitha, N.
Được phát hành: (1991)

On finite mixture of Pareto and Beta distributions
Bằng: Maya T. Nair
Được phát hành: (2007)

On truncated version of certain measures of inequality and stability
Bằng: Abdul Sathar, E. I.
Được phát hành: (2002)

An Extended pearson system useful in reliability analysis
Bằng: Sindu, T. K.
Được phát hành: (2002)

Modeling and analysis of competing risks data
Bằng: Sreedevi,E.P
Được phát hành: (2010)

Some characterization problems associated with the bivariate exponential and geometric distributions
Bằng: Muraleedharan Nair, K.R
Được phát hành: (1990)

Study of bayesian approach for certain reliability models
Bằng: Nishant Agarwal
Được phát hành: (2009)

Characterization of probability distributions using the residual entropy function
Bằng: Rajesh, G.
Được phát hành: (2001)

Studies on electrical and thermal properties of certain selected photonic matreials
Bằng: Edwin Xavier
Được phát hành: (1997)

Studies in field theories at finite temperature and finite Bosonic density
Bằng: Peter, V. J.
Được phát hành: (1995)

The Ph.D process a students guide to graduate school in the sciences
Bằng: Bloom,Dale F
Được phát hành: (1998)

A bivariate pareto distribution with Freund's dependence structure
Bằng: Jagathnath Krishna, K.M
Được phát hành: (2010)

Modeling and analysis of some heavy tailed time series
Bằng: Hareesh, G.
Được phát hành: (2010)

Modelling and analysis of lifetime data using reversed hazard rates
Bằng: Anjana, S
Được phát hành: (2015)