Ładuje się......

kod QR

Sri Ramavarma vijaya mahaakaavyam of M Kunjan Warrier: a critical study

Opis bibliograficzny
Główni autorzy:	Leelamani, K; Guide, Remadevi, V; Researcher
Format:	Ph.D Thesis
Wydane:	Kottayam, Mahatma Gandhi University 1999
Wydanie:	Ph.D
Hasła przedmiotowe:	Criticism and interpretation Criticism, Textual Dissertations, Academic (Ph.D) Epic poetry, Sanskrit Kunjan Warrier, M Sri Ramavarma vijayam Thesis (Ph.D)-Sanskrit literature

Podobne zapisy

Ładuje się......

Brhadaranyakopanishad: a study
od: Gangadharan Nair, G; Guide, i wsp.
Wydane: (1999)

Ładuje się......

Kavyakalanidhi of Krsnasudhi: a critical edition and study
od: Jayageetha, K N; Researcher, i wsp.
Wydane: (1998)

Ładuje się......

Adbhutapanjaram of Narayana Dikshita: a critical study
od: Ambika, C P; Researcher, i wsp.
Wydane: (1999)

Ładuje się......

Naisadhiyacarita- a grammatical evaluation
od: Gangadharan Nair, G; Guide, i wsp.
Wydane: (2007)

Ładuje się......

Karakatattva of Sesacakrapani: an edition and study
od: Leela, K N; Researcher, i wsp.
Wydane: (2006)

Ładuje się......

s of rat-fleas influence of larval environmental factors upon adult fecundity of Xenopsylla Cheopis and X.Astia(Insecta: Siphonaptera)
od: Remadevi, K
Wydane: (1980)

Ładuje się......

How to get a Ph.D a handbook for students and their supervisors
od: Phillips,Estelle M
Wydane: (1999)

Ładuje się......

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
od: Lali F Anand PhD
Wydane: (2015)

Ładuje się......

Clinical evaluation and surgical management of pigmentary keratitis in dogs
od: Anoop,s
Wydane: (2015)

Ładuje się......

Rasamanjari on Malatimadhava: a study
od: Paulose, K G; Guide, i wsp.
Wydane: (2006)

Ładuje się......

Influence of the story of saugandhikaharana on Kerala theatre
od: Aryadevi, T; Guide, i wsp.
Wydane: (2004)

Ładuje się......

A study of Tarkasamgraha as a compromise between the Nyaya and Vaisesika schools of philosophy
od: Arya Devi, T; Guide, i wsp.
Wydane: (2007)

Ładuje się......

Ratnaketudaya: study and critical edition
od: Jeena George; Researcher, i wsp.
Wydane: (2000)

Ładuje się......

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
od: Ramaswamy Iyengar, A; Guide, i wsp.
Wydane: (2011)

Ładuje się......

The concept of Iswaratattva in Nyaya Sastra
od: Aryadevi, T; Guide, i wsp.
Wydane: (2004)

Ładuje się......

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
od: Ajayakumar, M S,Researcher, i wsp.
Wydane: (2016)

Ładuje się......

Dasopanishdsu upasana-vimarsanatmakamadhyayam
od: Ajikumar, P V; Researcher, i wsp.
Wydane: (2012)

Ładuje się......

Krsnarjuniya: edition and study
od: Ambika, N S; Researcher, i wsp.
Wydane: (2008)

Ładuje się......

Hastalaksanadipika: a critical edition and study
od: Sudha, E K; Researcher, i wsp.
Wydane: (2004)

Ładuje się......

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
od: Chandrsekharan Nair, K; Guide, i wsp.
Wydane: (2012)

Ładuje się......

Treatment of karakas by Nagesa in Laghumanjusa
od: Aryadevi, T; Guide, i wsp.
Wydane: (2003)

Ładuje się......

Nalacharithathile bhaasha
od: Moosath, N N; Guide, i wsp.
Wydane: (1995)

Ładuje się......

Ph.D theses see T009

Ładuje się......

Microbial enzyme production utilizing Banana wastes
od: Krishna, C.
Wydane: (1995)

Ładuje się......

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
od: Ramachandran Nair, V. K.
Wydane: (1987)

Ładuje się......

Applications of the theory of stochastic processes to physical problems
od: Alladi Ramakrishnan
Wydane: (1951)

Ładuje się......

Characterizations of probability distributions: Some characterisations of pareto and related populations
od: Hitha, N.
Wydane: (1991)

Ładuje się......

On finite mixture of Pareto and Beta distributions
od: Maya T. Nair
Wydane: (2007)

Ładuje się......

On truncated version of certain measures of inequality and stability
od: Abdul Sathar, E. I.
Wydane: (2002)

Ładuje się......

An Extended pearson system useful in reliability analysis
od: Sindu, T. K.
Wydane: (2002)

Ładuje się......

Modeling and analysis of competing risks data
od: Sreedevi,E.P
Wydane: (2010)

Ładuje się......

Some characterization problems associated with the bivariate exponential and geometric distributions
od: Muraleedharan Nair, K.R
Wydane: (1990)

Ładuje się......

Study of bayesian approach for certain reliability models
od: Nishant Agarwal
Wydane: (2009)

Ładuje się......

Characterization of probability distributions using the residual entropy function
od: Rajesh, G.
Wydane: (2001)

Ładuje się......

Studies on electrical and thermal properties of certain selected photonic matreials
od: Edwin Xavier
Wydane: (1997)

Ładuje się......

Studies in field theories at finite temperature and finite Bosonic density
od: Peter, V. J.
Wydane: (1995)

Ładuje się......

The Ph.D process a students guide to graduate school in the sciences
od: Bloom,Dale F
Wydane: (1998)

Ładuje się......

A bivariate pareto distribution with Freund's dependence structure
od: Jagathnath Krishna, K.M
Wydane: (2010)

Ładuje się......

Modeling and analysis of some heavy tailed time series
od: Hareesh, G.
Wydane: (2010)

Ładuje się......

Modelling and analysis of lifetime data using reversed hazard rates
od: Anjana, S
Wydane: (2015)