Loading...

QR Code

Sri Ramavarma vijaya mahaakaavyam of M Kunjan Warrier: a critical study

Bibliographic Details
Main Authors:	Leelamani, K; Guide, Remadevi, V; Researcher
Format:	Ph.D Thesis
Published:	Kottayam, Mahatma Gandhi University 1999
Edition:	Ph.D
Subjects:	Criticism and interpretation Criticism, Textual Dissertations, Academic (Ph.D) Epic poetry, Sanskrit Kunjan Warrier, M Sri Ramavarma vijayam Thesis (Ph.D)-Sanskrit literature

Similar Items

Brhadaranyakopanishad: a study
by: Gangadharan Nair, G; Guide, et al.
Published: (1999)

Kavyakalanidhi of Krsnasudhi: a critical edition and study
by: Jayageetha, K N; Researcher, et al.
Published: (1998)

Adbhutapanjaram of Narayana Dikshita: a critical study
by: Ambika, C P; Researcher, et al.
Published: (1999)

Naisadhiyacarita- a grammatical evaluation
by: Gangadharan Nair, G; Guide, et al.
Published: (2007)

Karakatattva of Sesacakrapani: an edition and study
by: Leela, K N; Researcher, et al.
Published: (2006)

s of rat-fleas influence of larval environmental factors upon adult fecundity of Xenopsylla Cheopis and X.Astia(Insecta: Siphonaptera)
by: Remadevi, K
Published: (1980)

How to get a Ph.D a handbook for students and their supervisors
by: Phillips,Estelle M
Published: (1999)

Single nucleotide polymorphism of production associated loci in crossbred cattle of Kerala
by: Lali F Anand PhD
Published: (2015)

Clinical evaluation and surgical management of pigmentary keratitis in dogs
by: Anoop,s
Published: (2015)

Rasamanjari on Malatimadhava: a study
by: Paulose, K G; Guide, et al.
Published: (2006)

Influence of the story of saugandhikaharana on Kerala theatre
by: Aryadevi, T; Guide, et al.
Published: (2004)

A study of Tarkasamgraha as a compromise between the Nyaya and Vaisesika schools of philosophy
by: Arya Devi, T; Guide, et al.
Published: (2007)

Ratnaketudaya: study and critical edition
by: Jeena George; Researcher, et al.
Published: (2000)

A comparative study of sabda vyaparas according to naiyayikas,mimamsakas and vaiyakarans
by: Ramaswamy Iyengar, A; Guide, et al.
Published: (2011)

The concept of Iswaratattva in Nyaya Sastra
by: Aryadevi, T; Guide, et al.
Published: (2004)

Dramatic techniques of Kalidasa and Shakespeare – A comparative study
by: Ajayakumar, M S,Researcher, et al.
Published: (2016)

Dasopanishdsu upasana-vimarsanatmakamadhyayam
by: Ajikumar, P V; Researcher, et al.
Published: (2012)

Krsnarjuniya: edition and study
by: Ambika, N S; Researcher, et al.
Published: (2008)

Hastalaksanadipika: a critical edition and study
by: Sudha, E K; Researcher, et al.
Published: (2004)

Laghusabdendusekhara-prakriyasarvasva-laghupaniniya-vakyapadiyadyadharena karakanam samikshatmakam adhyayanam
by: Chandrsekharan Nair, K; Guide, et al.
Published: (2012)

Treatment of karakas by Nagesa in Laghumanjusa
by: Aryadevi, T; Guide, et al.
Published: (2003)

Nalacharithathile bhaasha
by: Moosath, N N; Guide, et al.
Published: (1995)

Ph.D theses see T009

Microbial enzyme production utilizing Banana wastes
by: Krishna, C.
Published: (1995)

Stochastic processes and their applications: Queueing models with reset to the server after serving a random number of units
by: Ramachandran Nair, V. K.
Published: (1987)

Applications of the theory of stochastic processes to physical problems
by: Alladi Ramakrishnan
Published: (1951)

Characterizations of probability distributions: Some characterisations of pareto and related populations
by: Hitha, N.
Published: (1991)

On finite mixture of Pareto and Beta distributions
by: Maya T. Nair
Published: (2007)

On truncated version of certain measures of inequality and stability
by: Abdul Sathar, E. I.
Published: (2002)

An Extended pearson system useful in reliability analysis
by: Sindu, T. K.
Published: (2002)

Modeling and analysis of competing risks data
by: Sreedevi,E.P
Published: (2010)

Some characterization problems associated with the bivariate exponential and geometric distributions
by: Muraleedharan Nair, K.R
Published: (1990)

Study of bayesian approach for certain reliability models
by: Nishant Agarwal
Published: (2009)

Characterization of probability distributions using the residual entropy function
by: Rajesh, G.
Published: (2001)

Studies on electrical and thermal properties of certain selected photonic matreials
by: Edwin Xavier
Published: (1997)

Studies in field theories at finite temperature and finite Bosonic density
by: Peter, V. J.
Published: (1995)

The Ph.D process a students guide to graduate school in the sciences
by: Bloom,Dale F
Published: (1998)

A bivariate pareto distribution with Freund's dependence structure
by: Jagathnath Krishna, K.M
Published: (2010)

Modeling and analysis of some heavy tailed time series
by: Hareesh, G.
Published: (2010)

Modelling and analysis of lifetime data using reversed hazard rates
by: Anjana, S
Published: (2015)